TB-500
$50.00
5 mg / vial
Third-Party Tested | U.S.–Made | Research-Grade
Out of stock
Guaranteed safe checkout
Description
Description
TB-500 (Thymosin β4) • 5 mg / vial
Tier One Biosystems – Third-Party Tested | U.S.–Made | Research-Grade
Biological Activity
TB-500 refers to thymosin β4 (Tβ4), a naturally occurring 43-amino-acid actin-sequestering peptide studied for roles in cell migration, angiogenesis, wound repair, and tissue regeneration in preclinical models. Tβ4’s intracellular function centers on buffering G-actin; extracellularly it has been investigated for pro-repair signaling across multiple tissues.
In Vivo / In Vitro Data
-
Widely used in cell and animal studies exploring wound healing, angiogenesis, cytoskeletal dynamics, and recovery after tissue injury. ScienceDirect
-
Experimental conditions vary by model (matrix, vehicle, dosing schedule). Follow your lab’s SOPs and the primary literature.
Purity & Documentation
-
Purity (HPLC): ≥99%
-
Independently verified for identity, potency, and sterility
Molecular Details
| Property | Value |
|---|---|
| Peptide Class | Full-length Thymosin β4 (43 aa) |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Chemical Formula (free peptide) | C₂₁₂H₃₅₀N₅₆O₇₈S |
| Average Molecular Weight | ~4963.5 g/mol |
| CAS No. | 77591-33-4 |
| INN (WHO) | Timbetasin |
Physical Properties
| Property | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Solubility (in vitro) | Soluble in H₂O and buffered aqueous media; soluble in DMSO (use minimal volumes; verify in-house) |
| Storage (sealed) | −20 °C (1 yr) or −80 °C (2 yrs); protect from light & moisture |
| Handling | After reconstitution; avoid repeat freeze–thaw cycles |
Shipping & Handling
Ships at ambient temperature within the U.S. unless otherwise requested. Maintain cold-chain conditions for extended storage upon receipt.
References
-
Wikipedia – Thymosin β4: 43-aa sequence; biological context; WHO INN (timbetasin). Wikipedia
-
PubChem – Timbetasin (Tβ4): formula C₂₁₂H₃₅₀N₅₆O₇₈S and identifiers. PubChem
-
Peptide Institute / vendor specs: molecular formula and MW ≈ 4963.5 Da for Tβ4. Shimadzu Chemistry & Diagnostics
-
Santa Cruz / ChemicalBook listings: CAS 77591-33-4, formula and MW confirmation. SCBT+1
-
Low et al., 1981 (PNAS/PMC): classical sequence paper for β-thymosin (≈ 43 aa). PMC
Research Use Only – Not for Human Consumption
Supplied exclusively for laboratory research, analytical testing, and scientific investigation.
Reviews (0)
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.